General Information

  • ID:  hor004680
  • Uniprot ID:  Q9SI57(104-116)
  • Protein name:  Probable root meristem growth factor 8
  • Gene name:  GLV6
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  RGF family
  • Source:  Plant
  • Expression:  In roots, present in both the quiescent center (QC) and the root apical meristem (RAM); within the meristem, mainly present in the cortex but also in the epidermal and procambial cells closest to the QC, with very strong levels in the initials surrounding
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYRTFRRRRPVHN
  • Length:  13(104-116)
  • Propeptide:  MKLIRVTLFLCALAILLLVTPTSSLQLKHPYSSPSQGLSKKIVTKMATRKLMIISSEYVMTSTSHEGSSEQLRVTSSGKSKDEEKKLSEEEEEKKALAKYLSMDYRTFRRRRPVHNKALPLDP
  • Signal peptide:  MKLIRVTLFLCALAILLLVTPTSSLQLKH
  • Modification:  T2 Sulfotyrosine;T10 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in maintaining the postembryonic root stem cell niche.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9SI57-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004680_AF2.pdbhor004680_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 198719 Formula: C76H121N31O19
Absent amino acids: ACEGIKLMQSW Common amino acids: R
pI: 12.33 Basic residues: 6
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -225.38 Boman Index: -9031
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 22.31
Instability Index: 18574.62 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  NA
  • Title:  NA