HORDB

ID: hor004680
Uniprot ID: Q9SI57
Protein name: Probable root meristem growth factor 8
Gene name: GLV6
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: RGF family
Source: Plant
Expression: In roots, present in both the quiescent center (QC) and the root apical meristem (RAM); within the meristem, mainly present in the cortex but also in the epidermal and procambial cells closest to the QC, with very strong levels in the initials surrounding
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
GO CC: GO:0005576 extracellular region

Sequence: DYRTFRRRRPVHN
Length: 13
Propeptide: MKLIRVTLFLCALAILLLVTPTSSLQLKHPYSSPSQGLSKKIVTKMATRKLMIISSEYVMTSTSHEGSSEQLRVTSSGKSKDEEKKLSEEEEEKKALAKYLSMDYRTFRRRRPVHNKALPLDP
Signal peptide: MKLIRVTLFLCALAILLLVTPTSSLQLKH
Modification: T2 Sulfotyrosine;T10 Hydroxyproline
Glycosylation: NA
Mutagenesis: NA

Function: May be involved in maintaining the postembryonic root stem cell niche.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004680_AF2.pdb

hor004680_ESM.pdb

Mass:	198719	Formula:	C76H121N31O19
Absent amino acids:	ACEGIKLMQSW	Common amino acids:	R
pI:	12.33	Basic residues:	6
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-225.38	Boman Index:	-9031
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	22.31
Instability Index:	18574.62	Extinction Coefficient cystines:	1490
Absorbance 280nm:	124.17